PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast02G167100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 346aa    MW: 37509.2 Da    PI: 9.3428
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast02G167100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.21.6e-5391361128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeel+ +yL+++++++++++ ++i++vdiyk++Pw Lp+k++ +++ewyfF++rd+ky++g r+nra+ sgyWkatg+dk+
  Brast02G167100.1.p   9 LPPGFRFHPTDEELILHYLRNRAAESPCPV-SIIADVDIYKFDPWALPSKANYGDREWYFFTPRDRKYPNGVRPNRAAGSGYWKATGTDKP 98 
                         79****************************.89***************999999************************************* PP

                 NAM  92 vlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         + s+ +ge vg+kk Lvfykgr pkg+kt+W+mheyrl
  Brast02G167100.1.p  99 IRSSaTGESVGVKKALVFYKGRPPKGVKTNWIMHEYRL 136
                         **9988999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.18E-645170IPR003441NAC domain
PROSITE profilePS5100561.9979170IPR003441NAC domain
PfamPF023651.4E-2710136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MIMSDPAMLP PGFRFHPTDE ELILHYLRNR AAESPCPVSI IADVDIYKFD PWALPSKANY  60
GDREWYFFTP RDRKYPNGVR PNRAAGSGYW KATGTDKPIR SSATGESVGV KKALVFYKGR  120
PPKGVKTNWI MHEYRLAAAD AHAGNTYRPM KFRNTSMRLD DWVLCRIYKK TSQMSPMAVP  180
PLSDHEHDEP CAYGGASSAG MMLQGGAGAA YPGHTLAGAQ RMPKIPSISE LLNEYSLAQL  240
LDEGGAGDIA RPDQHAAFLG HPIMNQYLAN SSGGNNNNNM SNLAQTTAGS EGATGKRKRS  300
EHGGDNGLTS QQKSNGSCFG ATTFQIGSNA LQGSLAPGNQ RLLHF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-72917217167NO APICAL MERISTEM PROTEIN
1ut4_B7e-72917217167NO APICAL MERISTEM PROTEIN
1ut7_A7e-72917217167NO APICAL MERISTEM PROTEIN
1ut7_B7e-72917217167NO APICAL MERISTEM PROTEIN
4dul_A7e-72917217167NAC domain-containing protein 19
4dul_B7e-72917217167NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00333DAPTransfer from AT3G04070Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2510580.0AK251058.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf97a05, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003557998.10.0PREDICTED: NAC transcription factor NAM-B1-like
TrEMBLI1H5X20.0I1H5X2_BRADI; Uncharacterized protein
STRINGBRADI1G63600.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123736123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.14e-85NAC domain containing protein 47